PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC027671.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family B3
Protein Properties Length: 300aa    MW: 34744.3 Da    PI: 8.9657
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC027671.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.62.2e-1842135198
                   EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                   ffkv +++++ +++ l++p  f+++h +k   +k++     s r W+vkl+   ++g+ +l++GW +Fv++ gL+ +D++vF+l++r++  + v +f
  EcC027671.20  42 FFKVVMRPSYVRKQ-LSIPSGFFRKHVQK---NKQIATLRYSDRLWQVKLRSFEHRGTAFLSNGWCSFVRETGLRLRDVCVFELIDRDDIVFSVYIF 134
                   78888888888886.***********544...23577777899*******9999*******************************998887888887 PP

                   - CS
            B3  98 r 98 
                   +
  EcC027671.20 135 N 135
                   6 PP

2B364.71.4e-20193287199
                   EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                   ffkv +++++ +++ l++p +f+++h +k+   k++   +   rsW+vkl+   ++g+ +lt+GW +F ++ gL+ gD++vF+l++r++  ++v++f
  EcC027671.20 193 FFKVVMRPSYVRQR-LSIPSEFFRKHVQKN---KQVATLSYLDRSWQVKLKSYDHRGMAFLTSGWPSFTRETGLRLGDVCVFELIDRDDIVFRVSIF 285
                   88999888888875.***********5443...3577777788*******99999999***************************999998999999 PP

                   -S CS
            B3  98 rk 99 
                   ++
  EcC027671.20 286 SS 287
                   75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.18E-2136136IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-2436137IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.23841137IPR003340B3 DNA binding domain
CDDcd100173.13E-1741135No hitNo description
SMARTSM010193.2E-1442137IPR003340B3 DNA binding domain
PfamPF023623.0E-1642135IPR003340B3 DNA binding domain
SuperFamilySSF1019369.02E-23187288IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-25187289IPR015300DNA-binding pseudobarrel domain
CDDcd100174.80E-19192286No hitNo description
PROSITE profilePS5086313.31192288IPR003340B3 DNA binding domain
SMARTSM010199.6E-19193288IPR003340B3 DNA binding domain
PfamPF023622.4E-18193287IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
RIEIGQSQCQ ESSLEPSFHG SPCLSPVTAH EKASGFESDH PFFKVVMRPS YVRKQLSIPS  60
GFFRKHVQKN KQIATLRYSD RLWQVKLRSF EHRGTAFLSN GWCSFVRETG LRLRDVCVFE  120
LIDRDDIVFS VYIFNSDVDT AYENSPLCSA GRIESKQSQH KESSSEPAFH FSPGLSPVSA  180
YEKARRFESD HPFFKVVMRP SYVRQRLSIP SEFFRKHVQK NKQVATLSYL DRSWQVKLKS  240
YDHRGMAFLT SGWPSFTRET GLRLGDVCVF ELIDRDDIVF RVSIFSSDGK DLIYVDRDEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A6e-142728527143B3 domain-containing transcription factor VRN
4i1k_B6e-142728527143B3 domain-containing transcription factor VRN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010065667.10.0PREDICTED: B3 domain-containing protein REM13-like isoform X1
TrEMBLA0A059BBI71e-168A0A059BBI7_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14804415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.14e-15related to vernalization1 1